Anti DCXR pAb (ATL-HPA023371 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA023371-25
  • Immunohistochemistry analysis in human liver and pancreas tissues using Anti-DCXR antibody. Corresponding DCXR RNA-seq data are presented for the same tissues.
  • Western blot analysis in human liver tissue.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added

Product Description

Protein Description: dicarbonyl/L-xylulose reductase
Gene Name: DCXR
Alternative Gene Name: DCR, KIDCR, SDR20C1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039450: 84%, ENSRNOG00000050315: 82%
Entrez Gene ID: 51181
Uniprot ID: Q7Z4W1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IRVNAVNPTVVMTSMGQATWSDPHKAKTMLNRIPLGKFAEVEHVVNAILFLLSDRSGMTTGSTLPVEG
Gene Sequence IRVNAVNPTVVMTSMGQATWSDPHKAKTMLNRIPLGKFAEVEHVVNAILFLLSDRSGMTTGSTLPVEG
Gene ID - Mouse ENSMUSG00000039450
Gene ID - Rat ENSRNOG00000050315
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti DCXR pAb (ATL-HPA023371 w/enhanced validation)
Datasheet Anti DCXR pAb (ATL-HPA023371 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DCXR pAb (ATL-HPA023371 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti DCXR pAb (ATL-HPA023371 w/enhanced validation)
Datasheet Anti DCXR pAb (ATL-HPA023371 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DCXR pAb (ATL-HPA023371 w/enhanced validation)

Citations

Citations for Anti DCXR pAb (ATL-HPA023371 w/enhanced validation) – 1 Found
Hubbs, Ann F; Cumpston, Amy M; Goldsmith, W Travis; Battelli, Lori A; Kashon, Michael L; Jackson, Mark C; Frazer, David G; Fedan, Jeffrey S; Goravanahally, Madhusudan P; Castranova, Vincent; Kreiss, Kathleen; Willard, Patsy A; Friend, Sherri; Schwegler-Berry, Diane; Fluharty, Kara L; Sriram, Krishnan. Respiratory and olfactory cytotoxicity of inhaled 2,3-pentanedione in Sprague-Dawley rats. The American Journal Of Pathology. 2012;181(3):829-44.  PubMed