Anti DCUN1D5 pAb (ATL-HPA050863)

Atlas Antibodies

SKU: ATL-HPA050863-100

• 
• 

Protein Description: DCN1, defective in cullin neddylation 1, domain containing 5
Gene Name: DCUN1D5
Alternative Gene Name: FLJ32431, MGC2714
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032002: 91%, ENSRNOG00000008390: 93%
Entrez Gene ID: 84259
Uniprot ID: Q9BTE7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MPVKKKRKSPGVAAAVAEDGGLKKCKISSYCRSQPPARLISGEEHFSSKKCLAWF
• Gene Sequence: MPVKKKRKSPGVAAAVAEDGGLKKCKISSYCRSQPPARLISGEEHFSSKKCLAWF
• Gene ID - Mouse: ENSMUSG00000032002
• Gene ID - Rat: ENSRNOG00000008390
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.