Anti DCPS pAb (ATL-HPA058597)

Atlas Antibodies

SKU: ATL-HPA058597-25

• 

Product Description

Protein Description: decapping enzyme, scavenger
Gene Name: DCPS
Alternative Gene Name: HINT-5, HSL1, HSPC015
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032040: 90%, ENSRNOG00000009993: 89%
Entrez Gene ID: 28960
Uniprot ID: Q96C86
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QFSNDIYSTYHLFPPRQLNDVKTTVVYPATEKHLQKYLRQDLRLIRETGDDYRNITLPHLESQSLSIQWVY
• Gene Sequence: QFSNDIYSTYHLFPPRQLNDVKTTVVYPATEKHLQKYLRQDLRLIRETGDDYRNITLPHLESQSLSIQWVY
• Gene ID - Mouse: ENSMUSG00000032040
• Gene ID - Rat: ENSRNOG00000009993
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links