Anti DCK pAb (ATL-HPA062773)

Atlas Antibodies

SKU:
ATL-HPA062773-25
  • Immunohistochemical staining of human lymph node shows strong cytoplasmic and nuclear positivity in germinal center cells.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG<br/>Lane 4: Human plasma<br/>Lane 5: Human Liver tissue<br/>Lane 6: Human Tonsil tissue
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: deoxycytidine kinase
Gene Name: DCK
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029366: 93%, ENSRNOG00000003296: 91%
Entrez Gene ID: 1633
Uniprot ID: P27707
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VNILKQLCEDWEVVPEPVARWCNVQSTQDEFEELTMSQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKD
Gene Sequence VNILKQLCEDWEVVPEPVARWCNVQSTQDEFEELTMSQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKD
Gene ID - Mouse ENSMUSG00000029366
Gene ID - Rat ENSRNOG00000003296
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DCK pAb (ATL-HPA062773)
Datasheet Anti DCK pAb (ATL-HPA062773) Datasheet (External Link)
Vendor Page Anti DCK pAb (ATL-HPA062773) at Atlas Antibodies

Documents & Links for Anti DCK pAb (ATL-HPA062773)
Datasheet Anti DCK pAb (ATL-HPA062773) Datasheet (External Link)
Vendor Page Anti DCK pAb (ATL-HPA062773)