Protein Description: dermcidin
Gene Name: DCD
Alternative Gene Name: AIDD, DCD-1, DSEP, HCAP, PIF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027488: 27%, ENSRNOG00000006846: 28%
Entrez Gene ID: 117159
Uniprot ID: P81605
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DCD
Alternative Gene Name: AIDD, DCD-1, DSEP, HCAP, PIF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027488: 27%, ENSRNOG00000006846: 28%
Entrez Gene ID: 117159
Uniprot ID: P81605
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | AYDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL |
| Documents & Links for Anti DCD pAb (ATL-HPA063967) | |
| Datasheet | Anti DCD pAb (ATL-HPA063967) Datasheet (External Link) |
| Vendor Page | Anti DCD pAb (ATL-HPA063967) at Atlas |
| Documents & Links for Anti DCD pAb (ATL-HPA063967) | |
| Datasheet | Anti DCD pAb (ATL-HPA063967) Datasheet (External Link) |
| Vendor Page | Anti DCD pAb (ATL-HPA063967) |
| Citations for Anti DCD pAb (ATL-HPA063967) – 2 Found |
| Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. PubMed |
| Gambichler, T; Elfering, J; Meyer, T; Bruckmüller, S; Stockfleth, E; Skrygan, M; Käfferlein, H U; Brüning, T; Lang, K; Wagener, D; Schröder, S; Nick, M; Susok, L. Protein expression of prognostic genes in primary melanoma and benign nevi. Journal Of Cancer Research And Clinical Oncology. 2022;148(10):2673-2680. PubMed |