Anti DCC pAb (ATL-HPA069552)

Atlas Antibodies

SKU: ATL-HPA069552-25

• 

Protein Description: DCC netrin 1 receptor
Gene Name: DCC
Alternative Gene Name: IGDCC1, NTN1R1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060534: 98%, ENSRNOG00000033099: 98%
Entrez Gene ID: 1630
Uniprot ID: P43146
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ACVRPTHPLRSFANPLLPPPMSAIEPKVPYTPLLSQPGPTLPKTHVKTASLGLAGKARSPLLPVSVPTAPEVSEESHKPTEDSANVYEQDDLSEQMAS
• Gene Sequence: ACVRPTHPLRSFANPLLPPPMSAIEPKVPYTPLLSQPGPTLPKTHVKTASLGLAGKARSPLLPVSVPTAPEVSEESHKPTEDSANVYEQDDLSEQMAS
• Gene ID - Mouse: ENSMUSG00000060534
• Gene ID - Rat: ENSRNOG00000033099
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti DCC pAb (ATL-HPA069552) – 1 Found

Patthey, Cedric; Tong, Yong Guang; Tait, Christine Mary; Wilson, Sara Ivy. Evolution of the functionally conserved DCC gene in birds. Scientific Reports. 2017;7( 28240293):42029.