Anti DCBLD1 pAb (ATL-HPA059667)

Atlas Antibodies

SKU: ATL-HPA059667-25

• 

Protein Description: discoidin, CUB and LCCL domain containing 1
Gene Name: DCBLD1
Alternative Gene Name: dJ94G16.1, MGC46341
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019891: 81%, ENSRNOG00000000407: 81%
Entrez Gene ID: 285761
Uniprot ID: Q8N8Z6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TFRPMDTDAEEAGVSTDAGGHYDCPQRAGRHEYALPLAPPEPEYATPIVERHVLRAHTFSAQSGYRVPGPQPGHKHSLSSGGF
• Gene Sequence: TFRPMDTDAEEAGVSTDAGGHYDCPQRAGRHEYALPLAPPEPEYATPIVERHVLRAHTFSAQSGYRVPGPQPGHKHSLSSGGF
• Gene ID - Mouse: ENSMUSG00000019891
• Gene ID - Rat: ENSRNOG00000000407
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.