Anti DCAF4 pAb (ATL-HPA047276)

Atlas Antibodies

SKU: ATL-HPA047276-25

• 
• 
• 

Protein Description: DDB1 and CUL4 associated factor 4
Gene Name: DCAF4
Alternative Gene Name: DKFZp434K114, WDR21, WDR21A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021222: 81%, ENSRNOG00000008399: 80%
Entrez Gene ID: 26094
Uniprot ID: Q8WV16
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TSSGTAGTSSVPELPGFYFDPEKKRYFRLLPGHNNCNPLTKESIRQKEMESKRLRLLQEEDRRK
• Gene Sequence: TSSGTAGTSSVPELPGFYFDPEKKRYFRLLPGHNNCNPLTKESIRQKEMESKRLRLLQEEDRRK
• Gene ID - Mouse: ENSMUSG00000021222
• Gene ID - Rat: ENSRNOG00000008399
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.