Anti DCAF17 pAb (ATL-HPA055040)

Atlas Antibodies

SKU:
ATL-HPA055040-25
  • Immunohistochemical staining of human cerebral cortex shows no positivity.
  • Immunofluorescent staining of human cell line Hep G2 shows localization to nucleoplasm & cytosol.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: DDB1 and CUL4 associated factor 17
Gene Name: DCAF17
Alternative Gene Name: C2orf37, FLJ13096
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041966: 99%, ENSRNOG00000009403: 97%
Entrez Gene ID: 80067
Uniprot ID: Q5H9S7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EQETFKIVDYEDELDLLSVVAVTQIDAEGKAHLDFHCNEYGTLLKSIPLVESWDVTYSHEVYFDRDLVLHIEQKPNRVFSCYVYQMICD
Gene Sequence EQETFKIVDYEDELDLLSVVAVTQIDAEGKAHLDFHCNEYGTLLKSIPLVESWDVTYSHEVYFDRDLVLHIEQKPNRVFSCYVYQMICD
Gene ID - Mouse ENSMUSG00000041966
Gene ID - Rat ENSRNOG00000009403
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DCAF17 pAb (ATL-HPA055040)
Datasheet Anti DCAF17 pAb (ATL-HPA055040) Datasheet (External Link)
Vendor Page Anti DCAF17 pAb (ATL-HPA055040) at Atlas Antibodies

Documents & Links for Anti DCAF17 pAb (ATL-HPA055040)
Datasheet Anti DCAF17 pAb (ATL-HPA055040) Datasheet (External Link)
Vendor Page Anti DCAF17 pAb (ATL-HPA055040)