Anti DCAF12L2 pAb (ATL-HPA053138)

Atlas Antibodies

SKU: ATL-HPA053138-25

• 

Protein Description: DDB1 and CUL4 associated factor 12-like 2
Gene Name: DCAF12L2
Alternative Gene Name: WDR40C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045284: 77%, ENSRNOG00000023458: 77%
Entrez Gene ID: 340578
Uniprot ID: Q5VW00
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SIAWHSEVGLPVYAHIRPRDVEAIPRASTNPSNRKVRAL
• Gene Sequence: SIAWHSEVGLPVYAHIRPRDVEAIPRASTNPSNRKVRAL
• Gene ID - Mouse: ENSMUSG00000045284
• Gene ID - Rat: ENSRNOG00000023458
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.