Anti DBF4B pAb (ATL-HPA048465)

Atlas Antibodies

SKU:
ATL-HPA048465-25
  • Immunohistochemical staining of human rectum shows strong cytoplasmic positivity with a granular pattern in glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: DBF4 zinc finger B
Gene Name: DBF4B
Alternative Gene Name: ASKL1, chifb, DRF1, FLJ13087, ZDBF1B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032816: 21%, ENSRNOG00000033496: 22%
Entrez Gene ID: 80174
Uniprot ID: Q8NFT6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HPSQENSFAPADIPVKGPLLFPEARPWLMSARCWVRPFPFVTWGCLIPHDTTPLHEEVSPCPCLRLGYLYLLLTQSLWCRVRVPSLSTAGPIPRTSHPCTLAFPSYLNDHDLGHLCQAKPQGWNTPQPFLHCGFLA
Gene Sequence HPSQENSFAPADIPVKGPLLFPEARPWLMSARCWVRPFPFVTWGCLIPHDTTPLHEEVSPCPCLRLGYLYLLLTQSLWCRVRVPSLSTAGPIPRTSHPCTLAFPSYLNDHDLGHLCQAKPQGWNTPQPFLHCGFLA
Gene ID - Mouse ENSMUSG00000032816
Gene ID - Rat ENSRNOG00000033496
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DBF4B pAb (ATL-HPA048465)
Datasheet Anti DBF4B pAb (ATL-HPA048465) Datasheet (External Link)
Vendor Page Anti DBF4B pAb (ATL-HPA048465) at Atlas Antibodies

Documents & Links for Anti DBF4B pAb (ATL-HPA048465)
Datasheet Anti DBF4B pAb (ATL-HPA048465) Datasheet (External Link)
Vendor Page Anti DBF4B pAb (ATL-HPA048465)