Anti DAPP1 pAb (ATL-HPA046074)

Atlas Antibodies

SKU: ATL-HPA046074-25

• 

Protein Description: dual adaptor of phosphotyrosine and 3-phosphoinositides
Gene Name: DAPP1
Alternative Gene Name: BAM32
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028159: 96%, ENSRNOG00000010575: 94%
Entrez Gene ID: 27071
Uniprot ID: Q9UN19
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HRNELKYFKDQMSPEPIRILDLTECSAVQFDYSQERVNCFCLVFPFRTFYLCAKTGVEADEWIKILRWKLSQIRKQLNQG
• Gene Sequence: HRNELKYFKDQMSPEPIRILDLTECSAVQFDYSQERVNCFCLVFPFRTFYLCAKTGVEADEWIKILRWKLSQIRKQLNQG
• Gene ID - Mouse: ENSMUSG00000028159
• Gene ID - Rat: ENSRNOG00000010575
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.