Anti DAOA pAb (ATL-HPA053114)

Atlas Antibodies

SKU:
ATL-HPA053114-25
  • Immunohistochemical staining of human kidney shows strong membranous positivity in cells in tubules.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: D-amino acid oxidase activator
Gene Name: DAOA
Alternative Gene Name: G72
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003452: 25%, ENSRNOG00000010999: 27%
Entrez Gene ID: 267012
Uniprot ID: P59103
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CPWVSYLPQPYAELEEVSSHVGKVFMARNYEFLAYEASKDRRQPLERMWTCNYNQQKDQSCNHKEITSTKA
Gene Sequence CPWVSYLPQPYAELEEVSSHVGKVFMARNYEFLAYEASKDRRQPLERMWTCNYNQQKDQSCNHKEITSTKA
Gene ID - Mouse ENSMUSG00000003452
Gene ID - Rat ENSRNOG00000010999
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DAOA pAb (ATL-HPA053114)
Datasheet Anti DAOA pAb (ATL-HPA053114) Datasheet (External Link)
Vendor Page Anti DAOA pAb (ATL-HPA053114) at Atlas Antibodies

Documents & Links for Anti DAOA pAb (ATL-HPA053114)
Datasheet Anti DAOA pAb (ATL-HPA053114) Datasheet (External Link)
Vendor Page Anti DAOA pAb (ATL-HPA053114)