Anti DAND5 pAb (ATL-HPA049472)

Atlas Antibodies

SKU:
ATL-HPA049472-25
  • Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: DAN domain family member 5, BMP antagonist
Gene Name: DAND5
Alternative Gene Name: CER2, CKTSF1B3, DANTE, DTE, FLJ38607, GREM3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053226: 65%, ENSRNOG00000033368: 65%
Entrez Gene ID: 199699
Uniprot ID: Q8N907
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GMCKAVPFVQVFSRPGCSAIRLRNHLCFGHCSSLYIPGSDPTPLVLCNSCMPARKRWAPVVLWCLTGSSASRRRVKISTMLIEGCHCSPKA
Gene Sequence GMCKAVPFVQVFSRPGCSAIRLRNHLCFGHCSSLYIPGSDPTPLVLCNSCMPARKRWAPVVLWCLTGSSASRRRVKISTMLIEGCHCSPKA
Gene ID - Mouse ENSMUSG00000053226
Gene ID - Rat ENSRNOG00000033368
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DAND5 pAb (ATL-HPA049472)
Datasheet Anti DAND5 pAb (ATL-HPA049472) Datasheet (External Link)
Vendor Page Anti DAND5 pAb (ATL-HPA049472) at Atlas Antibodies

Documents & Links for Anti DAND5 pAb (ATL-HPA049472)
Datasheet Anti DAND5 pAb (ATL-HPA049472) Datasheet (External Link)
Vendor Page Anti DAND5 pAb (ATL-HPA049472)