Protein Description: Dab, reelin signal transducer, homolog 1 (Drosophila)
Gene Name: DAB1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028519: 100%, ENSRNOG00000007410: 100%
Entrez Gene ID: 1600
Uniprot ID: O75553
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: DAB1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028519: 100%, ENSRNOG00000007410: 100%
Entrez Gene ID: 1600
Uniprot ID: O75553
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MSTETELQVAVKTSAKKDSRKKGQDRSEATLIKRFKGEGVRYKAKL |
| Documents & Links for Anti DAB1 pAb (ATL-HPA067495) | |
| Datasheet | Anti DAB1 pAb (ATL-HPA067495) Datasheet (External Link) |
| Vendor Page | Anti DAB1 pAb (ATL-HPA067495) at Atlas |
| Documents & Links for Anti DAB1 pAb (ATL-HPA067495) | |
| Datasheet | Anti DAB1 pAb (ATL-HPA067495) Datasheet (External Link) |
| Vendor Page | Anti DAB1 pAb (ATL-HPA067495) |