Anti DAAM2 pAb (ATL-HPA051300)

Atlas Antibodies

SKU:
ATL-HPA051300-25
  • Immunohistochemical staining of human cerebral cortex shows moderate positivity in neuropil.
  • Immunofluorescent staining of human cell line HEK 293 shows localization to nucleus & cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: dishevelled associated activator of morphogenesis 2
Gene Name: DAAM2
Alternative Gene Name: KIAA0381
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040260: 88%, ENSRNOG00000053945: 88%
Entrez Gene ID: 23500
Uniprot ID: Q86T65
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NISLLHYLIMILEKHFPDILNMPSELQHLPEAAKVNLAELEKEVGNLRRGLRAVEVELEYQRRQVREPS
Gene Sequence NISLLHYLIMILEKHFPDILNMPSELQHLPEAAKVNLAELEKEVGNLRRGLRAVEVELEYQRRQVREPS
Gene ID - Mouse ENSMUSG00000040260
Gene ID - Rat ENSRNOG00000053945
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DAAM2 pAb (ATL-HPA051300)
Datasheet Anti DAAM2 pAb (ATL-HPA051300) Datasheet (External Link)
Vendor Page Anti DAAM2 pAb (ATL-HPA051300) at Atlas Antibodies

Documents & Links for Anti DAAM2 pAb (ATL-HPA051300)
Datasheet Anti DAAM2 pAb (ATL-HPA051300) Datasheet (External Link)
Vendor Page Anti DAAM2 pAb (ATL-HPA051300)