Anti D2HGDH pAb (ATL-HPA060548)

Atlas Antibodies

Catalog No.:
ATL-HPA060548-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: D-2-hydroxyglutarate dehydrogenase
Gene Name: D2HGDH
Alternative Gene Name: D2HGD, FLJ42195, MGC25181
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073609: 82%, ENSRNOG00000019012: 84%
Entrez Gene ID: 728294
Uniprot ID: Q8N465
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VTDPEALQAPNVDWLRTLRGCSKVLLRPRTSEEVSHILRHCHERNLAVNPQGGNTGMVGGSVPVFDEIILSTARMNRVLSFHSVS
Gene Sequence VTDPEALQAPNVDWLRTLRGCSKVLLRPRTSEEVSHILRHCHERNLAVNPQGGNTGMVGGSVPVFDEIILSTARMNRVLSFHSVS
Gene ID - Mouse ENSMUSG00000073609
Gene ID - Rat ENSRNOG00000019012
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti D2HGDH pAb (ATL-HPA060548)
Datasheet Anti D2HGDH pAb (ATL-HPA060548) Datasheet (External Link)
Vendor Page Anti D2HGDH pAb (ATL-HPA060548) at Atlas Antibodies

Documents & Links for Anti D2HGDH pAb (ATL-HPA060548)
Datasheet Anti D2HGDH pAb (ATL-HPA060548) Datasheet (External Link)
Vendor Page Anti D2HGDH pAb (ATL-HPA060548)