Anti CYTH4 pAb (ATL-HPA071573)
Atlas Antibodies
- SKU:
- ATL-HPA071573-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CYTH4
Alternative Gene Name: CYT4, cytohesin-4, PSCD4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018008: 83%, ENSRNOG00000007679: 81%
Entrez Gene ID: 27128
Uniprot ID: Q9UIA0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MDLCHPEPAELSSGETEELQRIKWHRKQLLEDIQKL |
Gene Sequence | MDLCHPEPAELSSGETEELQRIKWHRKQLLEDIQKL |
Gene ID - Mouse | ENSMUSG00000018008 |
Gene ID - Rat | ENSRNOG00000007679 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CYTH4 pAb (ATL-HPA071573) | |
Datasheet | Anti CYTH4 pAb (ATL-HPA071573) Datasheet (External Link) |
Vendor Page | Anti CYTH4 pAb (ATL-HPA071573) at Atlas Antibodies |
Documents & Links for Anti CYTH4 pAb (ATL-HPA071573) | |
Datasheet | Anti CYTH4 pAb (ATL-HPA071573) Datasheet (External Link) |
Vendor Page | Anti CYTH4 pAb (ATL-HPA071573) |