Anti CYTH2 pAb (ATL-HPA060662)

Atlas Antibodies

SKU: ATL-HPA060662-25

• 

Protein Description: cytohesin 2
Gene Name: CYTH2
Alternative Gene Name: ARNO, CTS18.1, cytohesin-2, PSCD2, PSCD2L, Sec7p-L, Sec7p-like
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003269: 100%, ENSRNOG00000021051: 100%
Entrez Gene ID: 9266
Uniprot ID: Q99418
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: REELSEAMSEVEGLEANEGSKTLQRNRKMAMGRKKF
• Gene Sequence: REELSEAMSEVEGLEANEGSKTLQRNRKMAMGRKKF
• Gene ID - Mouse: ENSMUSG00000003269
• Gene ID - Rat: ENSRNOG00000021051
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.