Anti CYSTM1 pAb (ATL-HPA050930 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA050930-25

• 

Protein Description: cysteine-rich transmembrane module containing 1
Gene Name: CYSTM1
Alternative Gene Name: C5orf32, ORF1-FL49
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046727: 85%, ENSRNOG00000018775: 86%
Entrez Gene ID: 84418
Uniprot ID: Q9H1C7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QPMGPGPMGGPYPPPQGYPYQGYPQYGWQGGPQEPPKTTVYVVEDQRRDELG
• Gene Sequence: QPMGPGPMGGPYPPPQGYPYQGYPQYGWQGGPQEPPKTTVYVVEDQRRDELG
• Gene ID - Mouse: ENSMUSG00000046727
• Gene ID - Rat: ENSRNOG00000018775
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.