Protein Description: cytochrome P450, family 24, subfamily A, polypeptide 1
Gene Name: CYP24A1
Alternative Gene Name: CP24, CYP24, P450-CC24
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038567: 81%, ENSRNOG00000013062: 79%
Entrez Gene ID: 1591
Uniprot ID: Q07973
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CYP24A1
Alternative Gene Name: CP24, CYP24, P450-CC24
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038567: 81%, ENSRNOG00000013062: 79%
Entrez Gene ID: 1591
Uniprot ID: Q07973
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | KEGYGLLILEGEDWQRVRSAFQKKLMKPGEVMKLDNKINEVLADFMGRIDELCDERGHVEDLYSELN |
| Documents & Links for Anti CYP24A1 pAb (ATL-HPA063771) | |
| Datasheet | Anti CYP24A1 pAb (ATL-HPA063771) Datasheet (External Link) |
| Vendor Page | Anti CYP24A1 pAb (ATL-HPA063771) at Atlas |
| Documents & Links for Anti CYP24A1 pAb (ATL-HPA063771) | |
| Datasheet | Anti CYP24A1 pAb (ATL-HPA063771) Datasheet (External Link) |
| Vendor Page | Anti CYP24A1 pAb (ATL-HPA063771) |