Anti CYP24A1 pAb (ATL-HPA063771)

Atlas Antibodies

SKU: ATL-HPA063771-25

• 

Protein Description: cytochrome P450, family 24, subfamily A, polypeptide 1
Gene Name: CYP24A1
Alternative Gene Name: CP24, CYP24, P450-CC24
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038567: 81%, ENSRNOG00000013062: 79%
Entrez Gene ID: 1591
Uniprot ID: Q07973
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KEGYGLLILEGEDWQRVRSAFQKKLMKPGEVMKLDNKINEVLADFMGRIDELCDERGHVEDLYSELN
• Gene Sequence: KEGYGLLILEGEDWQRVRSAFQKKLMKPGEVMKLDNKINEVLADFMGRIDELCDERGHVEDLYSELN
• Gene ID - Mouse: ENSMUSG00000038567
• Gene ID - Rat: ENSRNOG00000013062
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.