Anti CYP20A1 pAb (ATL-HPA058461)

Atlas Antibodies

SKU: ATL-HPA058461-25

• 

Protein Description: cytochrome P450, family 20, subfamily A, polypeptide 1
Gene Name: CYP20A1
Alternative Gene Name: CYP-M
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049439: 84%, ENSRNOG00000017631: 83%
Entrez Gene ID: 57404
Uniprot ID: Q6UW02
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EVIRFQKNHGTVWSEIGKGFLDGSLDKNMTRKKQYEDALMQLESVLRNIIKERKGRNFSQHIFIDSLVQGNLNDQQILED
• Gene Sequence: EVIRFQKNHGTVWSEIGKGFLDGSLDKNMTRKKQYEDALMQLESVLRNIIKERKGRNFSQHIFIDSLVQGNLNDQQILED
• Gene ID - Mouse: ENSMUSG00000049439
• Gene ID - Rat: ENSRNOG00000017631
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.