Anti CYP19A1 pAb (ATL-HPA051194 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA051194-25

• 
• 

Protein Description: cytochrome P450, family 19, subfamily A, polypeptide 1
Gene Name: CYP19A1
Alternative Gene Name: ARO, ARO1, aromatase, CPV1, CYAR, CYP19, P-450AROM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032274: 89%, ENSRNOG00000000196: 86%
Entrez Gene ID: 1588
Uniprot ID: P11511
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IGERDIKIDDIQKLKVMENFIYESMRYQPVVDLVMRKALEDDVIDGYPVKKGTNIILNIGRMHRLEFFPKPNEFTL
• Gene Sequence: IGERDIKIDDIQKLKVMENFIYESMRYQPVVDLVMRKALEDDVIDGYPVKKGTNIILNIGRMHRLEFFPKPNEFTL
• Gene ID - Mouse: ENSMUSG00000032274
• Gene ID - Rat: ENSRNOG00000000196
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.