Anti CYP11B2 pAb (ATL-HPA049171 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA049171-25

• 

Protein Description: cytochrome P450, family 11, subfamily B, polypeptide 2
Gene Name: CYP11B2
Alternative Gene Name: ALDOS, CPN2, CYP11B, CYP11BL, P-450C18, P450aldo
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022589: 65%, ENSRNOG00000030111: 65%
Entrez Gene ID: 1585
Uniprot ID: P19099
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCL
• Gene Sequence: FLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCL
• Gene ID - Mouse: ENSMUSG00000022589
• Gene ID - Rat: ENSRNOG00000030111
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.