Anti CYLD pAb (ATL-HPA050095)

Atlas Antibodies

SKU: ATL-HPA050095-25

• 
• 

Protein Description: cylindromatosis (turban tumor syndrome)
Gene Name: CYLD
Alternative Gene Name: CYLD1, KIAA0849, USPL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036712: 95%, ENSRNOG00000014048: 81%
Entrez Gene ID: 1540
Uniprot ID: Q9NQC7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PPLEINSRVSLKVGETIESGTVIFCDVLPGKESLGYFVGVDMDNPIGNWDGRFDGVQLCSFACVESTILLHINDIIPESVTQER
• Gene Sequence: PPLEINSRVSLKVGETIESGTVIFCDVLPGKESLGYFVGVDMDNPIGNWDGRFDGVQLCSFACVESTILLHINDIIPESVTQER
• Gene ID - Mouse: ENSMUSG00000036712
• Gene ID - Rat: ENSRNOG00000014048
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.