Anti CYLD pAb (ATL-HPA050095)

Atlas Antibodies

SKU:
ATL-HPA050095-25
  • Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to microtubule organizing center.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: cylindromatosis (turban tumor syndrome)
Gene Name: CYLD
Alternative Gene Name: CYLD1, KIAA0849, USPL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036712: 95%, ENSRNOG00000014048: 81%
Entrez Gene ID: 1540
Uniprot ID: Q9NQC7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PPLEINSRVSLKVGETIESGTVIFCDVLPGKESLGYFVGVDMDNPIGNWDGRFDGVQLCSFACVESTILLHINDIIPESVTQER
Gene Sequence PPLEINSRVSLKVGETIESGTVIFCDVLPGKESLGYFVGVDMDNPIGNWDGRFDGVQLCSFACVESTILLHINDIIPESVTQER
Gene ID - Mouse ENSMUSG00000036712
Gene ID - Rat ENSRNOG00000014048
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CYLD pAb (ATL-HPA050095)
Datasheet Anti CYLD pAb (ATL-HPA050095) Datasheet (External Link)
Vendor Page Anti CYLD pAb (ATL-HPA050095) at Atlas Antibodies

Documents & Links for Anti CYLD pAb (ATL-HPA050095)
Datasheet Anti CYLD pAb (ATL-HPA050095) Datasheet (External Link)
Vendor Page Anti CYLD pAb (ATL-HPA050095)