Anti CYBB pAb (ATL-HPA051227 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA051227-100
- Shipping:
- Calculated at Checkout
$554.00
Gene Name: CYBB
Alternative Gene Name: CGD, GP91-PHOX, NOX2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015340: 76%, ENSRNOG00000003622: 80%
Entrez Gene ID: 1536
Uniprot ID: P04839
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FNVEWCVNARVNNSDPYSVALSELGDRQNESYLNFARKRIKNPEGGLYLA |
Gene Sequence | FNVEWCVNARVNNSDPYSVALSELGDRQNESYLNFARKRIKNPEGGLYLA |
Gene ID - Mouse | ENSMUSG00000015340 |
Gene ID - Rat | ENSRNOG00000003622 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CYBB pAb (ATL-HPA051227 w/enhanced validation) | |
Datasheet | Anti CYBB pAb (ATL-HPA051227 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CYBB pAb (ATL-HPA051227 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti CYBB pAb (ATL-HPA051227 w/enhanced validation) | |
Datasheet | Anti CYBB pAb (ATL-HPA051227 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CYBB pAb (ATL-HPA051227 w/enhanced validation) |
Citations for Anti CYBB pAb (ATL-HPA051227 w/enhanced validation) – 1 Found |
Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. PubMed |