Anti CYB5A pAb (ATL-HPA058547 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA058547-100

• 
• 
• 

Protein Description: cytochrome b5 type A (microsomal)
Gene Name: CYB5A
Alternative Gene Name: CYB5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024646: 85%, ENSRNOG00000015205: 87%
Entrez Gene ID: 1528
Uniprot ID: P00167
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLAEHPGG
• Gene Sequence: MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLAEHPGG
• Gene ID - Mouse: ENSMUSG00000024646
• Gene ID - Rat: ENSRNOG00000015205
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.