Anti CXorf65 pAb (ATL-HPA047396)
Atlas Antibodies
- SKU:
- ATL-HPA047396-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CXorf65
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000092463: 38%, ENSRNOG00000003954: 37%
Entrez Gene ID: 158830
Uniprot ID: A6NEN9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GTRLENAYRAFVPLLKNPEPWLLVALRIQCDALERRRIQMLKMKEAKKVVIIEPPASVPSKQSGRSDKKKSTRKSPTFRNRPDFRKNKGRQLNKTTKQK |
Gene Sequence | GTRLENAYRAFVPLLKNPEPWLLVALRIQCDALERRRIQMLKMKEAKKVVIIEPPASVPSKQSGRSDKKKSTRKSPTFRNRPDFRKNKGRQLNKTTKQK |
Gene ID - Mouse | ENSMUSG00000092463 |
Gene ID - Rat | ENSRNOG00000003954 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CXorf65 pAb (ATL-HPA047396) | |
Datasheet | Anti CXorf65 pAb (ATL-HPA047396) Datasheet (External Link) |
Vendor Page | Anti CXorf65 pAb (ATL-HPA047396) at Atlas Antibodies |
Documents & Links for Anti CXorf65 pAb (ATL-HPA047396) | |
Datasheet | Anti CXorf65 pAb (ATL-HPA047396) Datasheet (External Link) |
Vendor Page | Anti CXorf65 pAb (ATL-HPA047396) |