Anti CXorf38 pAb (ATL-HPA050120 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA050120-25
  • Immunohistochemical staining of human colon shows moderate cytoplasmic and nuclear positivity in glandular cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
  • Western blot analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-CXorf38 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: chromosome X open reading frame 38
Gene Name: CXorf38
Alternative Gene Name: MGC39350
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044148: 69%, ENSRNOG00000023187: 66%
Entrez Gene ID: 159013
Uniprot ID: Q8TB03
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DGCECEMGTYLSESQVNEIEMQLLKEKLQEIYLQAEEQEVLPEELSNRLEVVKEFLRNNEDLRNGLTEDMQKLDSLCLHQKLDSQEPG
Gene Sequence DGCECEMGTYLSESQVNEIEMQLLKEKLQEIYLQAEEQEVLPEELSNRLEVVKEFLRNNEDLRNGLTEDMQKLDSLCLHQKLDSQEPG
Gene ID - Mouse ENSMUSG00000044148
Gene ID - Rat ENSRNOG00000023187
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti CXorf38 pAb (ATL-HPA050120 w/enhanced validation)
Datasheet Anti CXorf38 pAb (ATL-HPA050120 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CXorf38 pAb (ATL-HPA050120 w/enhanced validation)