Anti CX3CR1 pAb (ATL-HPA046587)

Atlas Antibodies

SKU: ATL-HPA046587-25

• 

Protein Description: chemokine (C-X3-C motif) receptor 1
Gene Name: CX3CR1
Alternative Gene Name: CCRL1, CMKBRL1, CMKDR1, GPR13, V28
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052336: 38%, ENSRNOG00000018509: 38%
Entrez Gene ID: 1524
Uniprot ID: P49238
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LEAFKLADLDFRKSSLASGWRMASGAFTMDQFPESVTENFEYDDLAEACYIGDIVVFGTVF
• Gene Sequence: LEAFKLADLDFRKSSLASGWRMASGAFTMDQFPESVTENFEYDDLAEACYIGDIVVFGTVF
• Gene ID - Mouse: ENSMUSG00000052336
• Gene ID - Rat: ENSRNOG00000018509
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.