Protein Description: CWC27 spliceosome-associated protein homolog
Gene Name: CWC27
Alternative Gene Name: NY-CO-10, SDCCAG-10, SDCCAG10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021715: 94%, ENSRNOG00000013252: 93%
Entrez Gene ID: 10283
Uniprot ID: Q6UX04
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CWC27
Alternative Gene Name: NY-CO-10, SDCCAG-10, SDCCAG10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021715: 94%, ENSRNOG00000013252: 93%
Entrez Gene ID: 10283
Uniprot ID: Q6UX04
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | TGSGGESIYGAPFKDEFHSRLRFNRRGLVAMANAGSHDNGSQFFFTLGRADELNNKHTIFGKVTGDTVYNMLRLSEVDIDDDERPHNPH |
| Documents & Links for Anti CWC27 pAb (ATL-HPA065809) | |
| Datasheet | Anti CWC27 pAb (ATL-HPA065809) Datasheet (External Link) |
| Vendor Page | Anti CWC27 pAb (ATL-HPA065809) at Atlas |
| Documents & Links for Anti CWC27 pAb (ATL-HPA065809) | |
| Datasheet | Anti CWC27 pAb (ATL-HPA065809) Datasheet (External Link) |
| Vendor Page | Anti CWC27 pAb (ATL-HPA065809) |