Protein Description: CUB and zona pellucida-like domains 1
Gene Name: CUZD1
Alternative Gene Name: ERG-1, UO-44
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040205: 65%, ENSRNOG00000029945: 65%
Entrez Gene ID: 50624
Uniprot ID: Q86UP6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CUZD1
Alternative Gene Name: ERG-1, UO-44
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040205: 65%, ENSRNOG00000029945: 65%
Entrez Gene ID: 50624
Uniprot ID: Q86UP6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SNGNNLQLKDPTCRPKLSNVVEFSVPLNGCGTIRKVEDQSITYTNIITFSASSTSEVITRQKQLQIIVKCEM |
| Documents & Links for Anti CUZD1 pAb (ATL-HPA074117) | |
| Datasheet | Anti CUZD1 pAb (ATL-HPA074117) Datasheet (External Link) |
| Vendor Page | Anti CUZD1 pAb (ATL-HPA074117) at Atlas |
| Documents & Links for Anti CUZD1 pAb (ATL-HPA074117) | |
| Datasheet | Anti CUZD1 pAb (ATL-HPA074117) Datasheet (External Link) |
| Vendor Page | Anti CUZD1 pAb (ATL-HPA074117) |