Anti CTSK pAb (ATL-HPA050346)

Atlas Antibodies

SKU:
ATL-HPA050346-25
  • Immunofluorescent staining of human cell line SK-MEL-30 shows localization to nucleoplasm & vesicles.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: cathepsin K
Gene Name: CTSK
Alternative Gene Name: CTSO, CTSO2, PKND, PYCD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028111: 83%, ENSRNOG00000021155: 85%
Entrez Gene ID: 1513
Uniprot ID: P43235
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASF
Gene Sequence LAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASF
Gene ID - Mouse ENSMUSG00000028111
Gene ID - Rat ENSRNOG00000021155
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CTSK pAb (ATL-HPA050346)
Datasheet Anti CTSK pAb (ATL-HPA050346) Datasheet (External Link)
Vendor Page Anti CTSK pAb (ATL-HPA050346) at Atlas Antibodies

Documents & Links for Anti CTSK pAb (ATL-HPA050346)
Datasheet Anti CTSK pAb (ATL-HPA050346) Datasheet (External Link)
Vendor Page Anti CTSK pAb (ATL-HPA050346)