Anti CTPS1 pAb (ATL-HPA051322 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA051322-100

• 
• 

Protein Description: CTP synthase 1
Gene Name: CTPS1
Alternative Gene Name: CTPS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028633: 94%, ENSRNOG00000009963: 94%
Entrez Gene ID: 1503
Uniprot ID: P17812
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PYFGLLLASVGRLSHYLQKGCRLSPRDTYSDRSGSSSPDSEITELKFPSINHD
• Gene Sequence: PYFGLLLASVGRLSHYLQKGCRLSPRDTYSDRSGSSSPDSEITELKFPSINHD
• Gene ID - Mouse: ENSMUSG00000028633
• Gene ID - Rat: ENSRNOG00000009963
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.