Anti CTHRC1 pAb (ATL-HPA059806)

Atlas Antibodies

SKU: ATL-HPA059806-25

• 
• 

Protein Description: collagen triple helix repeat containing 1
Gene Name: CTHRC1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000106929: 98%, ENSRNOG00000004578: 98%
Entrez Gene ID: 115908
Uniprot ID: Q96CG8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AIIYLDQGSPEMNSTINIHRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRI
• Gene Sequence: AIIYLDQGSPEMNSTINIHRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRI
• Gene ID - Mouse: ENSMUSG00000106929
• Gene ID - Rat: ENSRNOG00000004578
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.