Protein Description: CTD phosphatase subunit 1
Gene Name: CTDP1
Alternative Gene Name: FCP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033323: 91%, ENSRNOG00000061474: 88%
Entrez Gene ID: 9150
Uniprot ID: Q9Y5B0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CTDP1
Alternative Gene Name: FCP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033323: 91%, ENSRNOG00000061474: 88%
Entrez Gene ID: 9150
Uniprot ID: Q9Y5B0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | IFSGLHPTNFPIEKTREHYHATALGAKILTRLVLSPDAPDRATHLIAARAGTEKVLQAQECGHLHVVNPDWLWSCLERWDKVEEQLFPLRDDHTK |
| Documents & Links for Anti CTDP1 pAb (ATL-HPA070389) | |
| Datasheet | Anti CTDP1 pAb (ATL-HPA070389) Datasheet (External Link) |
| Vendor Page | Anti CTDP1 pAb (ATL-HPA070389) at Atlas |
| Documents & Links for Anti CTDP1 pAb (ATL-HPA070389) | |
| Datasheet | Anti CTDP1 pAb (ATL-HPA070389) Datasheet (External Link) |
| Vendor Page | Anti CTDP1 pAb (ATL-HPA070389) |