Protein Description: CTD nuclear envelope phosphatase 1
Gene Name: CTDNEP1
Alternative Gene Name: DULLARD, HSA011916, NET56
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018559: 98%, ENSRNOG00000017352: 98%
Entrez Gene ID: 23399
Uniprot ID: O95476
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CTDNEP1
Alternative Gene Name: DULLARD, HSA011916, NET56
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018559: 98%, ENSRNOG00000017352: 98%
Entrez Gene ID: 23399
Uniprot ID: O95476
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | QIRTVIQYQTVRYDILPLSPVSRNRLAQVKRKILVLDLDETLIHSHHDG |
| Documents & Links for Anti CTDNEP1 pAb (ATL-HPA066466) | |
| Datasheet | Anti CTDNEP1 pAb (ATL-HPA066466) Datasheet (External Link) |
| Vendor Page | Anti CTDNEP1 pAb (ATL-HPA066466) at Atlas |
| Documents & Links for Anti CTDNEP1 pAb (ATL-HPA066466) | |
| Datasheet | Anti CTDNEP1 pAb (ATL-HPA066466) Datasheet (External Link) |
| Vendor Page | Anti CTDNEP1 pAb (ATL-HPA066466) |