Anti CTDNEP1 pAb (ATL-HPA066466)

Atlas Antibodies

SKU: ATL-HPA066466-25

• 

Protein Description: CTD nuclear envelope phosphatase 1
Gene Name: CTDNEP1
Alternative Gene Name: DULLARD, HSA011916, NET56
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018559: 98%, ENSRNOG00000017352: 98%
Entrez Gene ID: 23399
Uniprot ID: O95476
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QIRTVIQYQTVRYDILPLSPVSRNRLAQVKRKILVLDLDETLIHSHHDG
• Gene Sequence: QIRTVIQYQTVRYDILPLSPVSRNRLAQVKRKILVLDLDETLIHSHHDG
• Gene ID - Mouse: ENSMUSG00000018559
• Gene ID - Rat: ENSRNOG00000017352
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.