Anti CSTF1 pAb (ATL-HPA065000)
Atlas Antibodies
- SKU:
- ATL-HPA065000-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CSTF1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027498: 99%, ENSRNOG00000004775: 99%
Entrez Gene ID: 1477
Uniprot ID: Q05048
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AKLWEISTGRTLVRYTGAGLSGRQVHRTQAVFNHTEDYVLLPDERTISLCCWDSRTAERRNLLSLGHNNIVRCIVHSPTNPGFMTCSDDFRARFWYRRS |
Gene Sequence | AKLWEISTGRTLVRYTGAGLSGRQVHRTQAVFNHTEDYVLLPDERTISLCCWDSRTAERRNLLSLGHNNIVRCIVHSPTNPGFMTCSDDFRARFWYRRS |
Gene ID - Mouse | ENSMUSG00000027498 |
Gene ID - Rat | ENSRNOG00000004775 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CSTF1 pAb (ATL-HPA065000) | |
Datasheet | Anti CSTF1 pAb (ATL-HPA065000) Datasheet (External Link) |
Vendor Page | Anti CSTF1 pAb (ATL-HPA065000) at Atlas Antibodies |
Documents & Links for Anti CSTF1 pAb (ATL-HPA065000) | |
Datasheet | Anti CSTF1 pAb (ATL-HPA065000) Datasheet (External Link) |
Vendor Page | Anti CSTF1 pAb (ATL-HPA065000) |