Anti CSTF1 pAb (ATL-HPA047275)

Atlas Antibodies

SKU: ATL-HPA047275-25

• 
• 

Protein Description: cleavage stimulation factor, 3' pre-RNA, subunit 1, 50kDa
Gene Name: CSTF1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027498: 100%, ENSRNOG00000004775: 100%
Entrez Gene ID: 1477
Uniprot ID: Q05048
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TGSADASIKILDTERMLAKSAMPIEVMMNETAQQNMENHPVIRTLYDHVDEVTCLAFHPTEQILASGSRDYTLKLFDYSKPSAKRAFKYIQEAEMLRSIS
• Gene Sequence: TGSADASIKILDTERMLAKSAMPIEVMMNETAQQNMENHPVIRTLYDHVDEVTCLAFHPTEQILASGSRDYTLKLFDYSKPSAKRAFKYIQEAEMLRSIS
• Gene ID - Mouse: ENSMUSG00000027498
• Gene ID - Rat: ENSRNOG00000004775
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.