Anti CSPG5 pAb (ATL-HPA049529)
Atlas Antibodies
- SKU:
- ATL-HPA049529-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CSPG5
Alternative Gene Name: NGC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032482: 89%, ENSRNOG00000020833: 89%
Entrez Gene ID: 10675
Uniprot ID: O95196
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SLSTIAEGSHPNVRKLCNTPRTSSPHARALAHYDNVICQDDPSAPHKIQEVLKSCLKEEESFNIQNSMSPKLEGGKGDQADLDVNCL |
Gene Sequence | SLSTIAEGSHPNVRKLCNTPRTSSPHARALAHYDNVICQDDPSAPHKIQEVLKSCLKEEESFNIQNSMSPKLEGGKGDQADLDVNCL |
Gene ID - Mouse | ENSMUSG00000032482 |
Gene ID - Rat | ENSRNOG00000020833 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CSPG5 pAb (ATL-HPA049529) | |
Datasheet | Anti CSPG5 pAb (ATL-HPA049529) Datasheet (External Link) |
Vendor Page | Anti CSPG5 pAb (ATL-HPA049529) at Atlas Antibodies |
Documents & Links for Anti CSPG5 pAb (ATL-HPA049529) | |
Datasheet | Anti CSPG5 pAb (ATL-HPA049529) Datasheet (External Link) |
Vendor Page | Anti CSPG5 pAb (ATL-HPA049529) |