Anti CSMD2 pAb (ATL-HPA008622)

Atlas Antibodies

SKU: ATL-HPA008622-25

• 

Protein Description: CUB and Sushi multiple domains 2
Gene Name: CSMD2
Alternative Gene Name: KIAA1884
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028804: 94%, ENSRNOG00000007057: 92%
Entrez Gene ID: 114784
Uniprot ID: Q7Z408
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RYSAPYCSLPRAPLHGFILGQTSTQPGGSIHFGCNAGYRLVGHSMAICTRHPQGYHLWSEAIPLCQALSCGLPEAPKNGMVFGKEYTVGTKAMYSCSEGYHLQAGAEATAECLDTGLWSNRNVPPQCVPVTCPDVSSISVEH
• Gene Sequence: RYSAPYCSLPRAPLHGFILGQTSTQPGGSIHFGCNAGYRLVGHSMAICTRHPQGYHLWSEAIPLCQALSCGLPEAPKNGMVFGKEYTVGTKAMYSCSEGYHLQAGAEATAECLDTGLWSNRNVPPQCVPVTCPDVSSISVEH
• Gene ID - Mouse: ENSMUSG00000028804
• Gene ID - Rat: ENSRNOG00000007057
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.