Anti CSDE1 pAb (ATL-HPA052221)

Atlas Antibodies

SKU:
ATL-HPA052221-25
  • Immunohistochemical staining of human testis shows moderate granular positivity in cytoplasm in cells in seminiferous ducts.
  • Immunofluorescent staining of human cell line MCF7 shows localization to cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: cold shock domain containing E1, RNA-binding
Gene Name: CSDE1
Alternative Gene Name: D1S155E, UNR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068823: 99%, ENSRNOG00000061058: 99%
Entrez Gene ID: 7812
Uniprot ID: O75534
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VSFHSHSDHRFLGTVEKEATFSNPKTTSPNKGKEKEAEDGIIAYDDCGVKLTIAFQAKDVEGSTSPQIGDKVEFSISDKQRPGQQVATCVRLLGRNSNSKRLLGYVATLKDNFGFIETANHDKEIFFHYSEFSGDVD
Gene Sequence VSFHSHSDHRFLGTVEKEATFSNPKTTSPNKGKEKEAEDGIIAYDDCGVKLTIAFQAKDVEGSTSPQIGDKVEFSISDKQRPGQQVATCVRLLGRNSNSKRLLGYVATLKDNFGFIETANHDKEIFFHYSEFSGDVD
Gene ID - Mouse ENSMUSG00000068823
Gene ID - Rat ENSRNOG00000061058
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CSDE1 pAb (ATL-HPA052221)
Datasheet Anti CSDE1 pAb (ATL-HPA052221) Datasheet (External Link)
Vendor Page Anti CSDE1 pAb (ATL-HPA052221) at Atlas Antibodies

Documents & Links for Anti CSDE1 pAb (ATL-HPA052221)
Datasheet Anti CSDE1 pAb (ATL-HPA052221) Datasheet (External Link)
Vendor Page Anti CSDE1 pAb (ATL-HPA052221)



Citations for Anti CSDE1 pAb (ATL-HPA052221) – 1 Found
Booy, Evan P; McRae, Ewan Ks; Ezzati, Peyman; Choi, Taegi; Gussakovsky, Daniel; McKenna, Sean A. Comprehensive analysis of the BC200 ribonucleoprotein reveals a reciprocal regulatory function with CSDE1/UNR. Nucleic Acids Research. 2018;46(21):11575-11591.  PubMed