Anti CRYGN pAb (ATL-HPA050788)

Atlas Antibodies

SKU:
ATL-HPA050788-100
  • Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and CRYGN over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY408155).
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: crystallin, gamma N
Gene Name: CRYGN
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038135: 42%, ENSRNOG00000009226: 42%
Entrez Gene ID: 155051
Uniprot ID: Q8WXF5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EIFEGCNFTGQCLEFLEDSPFLQSRGWVKNCVNTIKVYGDGAAWSPRSFGAEDFQLSSSLQSDQGPEEATTKPATTQPPFLTANL
Gene Sequence EIFEGCNFTGQCLEFLEDSPFLQSRGWVKNCVNTIKVYGDGAAWSPRSFGAEDFQLSSSLQSDQGPEEATTKPATTQPPFLTANL
Gene ID - Mouse ENSMUSG00000038135
Gene ID - Rat ENSRNOG00000009226
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CRYGN pAb (ATL-HPA050788)
Datasheet Anti CRYGN pAb (ATL-HPA050788) Datasheet (External Link)
Vendor Page Anti CRYGN pAb (ATL-HPA050788) at Atlas Antibodies

Documents & Links for Anti CRYGN pAb (ATL-HPA050788)
Datasheet Anti CRYGN pAb (ATL-HPA050788) Datasheet (External Link)
Vendor Page Anti CRYGN pAb (ATL-HPA050788)