Anti CRHBP pAb (ATL-HPA046120)

Atlas Antibodies

SKU: ATL-HPA046120-25

• 
• 

Protein Description: corticotropin releasing hormone binding protein
Gene Name: CRHBP
Alternative Gene Name: CRF-BP, CRFBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021680: 84%, ENSRNOG00000017890: 81%
Entrez Gene ID: 1393
Uniprot ID: P24387
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVE
• Gene Sequence: TLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVE
• Gene ID - Mouse: ENSMUSG00000021680
• Gene ID - Rat: ENSRNOG00000017890
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.