Anti CREBBP pAb (ATL-HPA055861 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA055861-25

• 
• 

Protein Description: CREB binding protein
Gene Name: CREBBP
Alternative Gene Name: CBP, KAT3A, RSTS, RTS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022521: 82%, ENSRNOG00000005330: 84%
Entrez Gene ID: 1387
Uniprot ID: Q92793
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VASAETNSQQPGPDVPVLEMKTETQAEDTEPDPGESKGEPRSEMMEEDLQGASQVKEETDIAEQKSEPMEVDE
• Gene Sequence: VASAETNSQQPGPDVPVLEMKTETQAEDTEPDPGESKGEPRSEMMEEDLQGASQVKEETDIAEQKSEPMEVDE
• Gene ID - Mouse: ENSMUSG00000022521
• Gene ID - Rat: ENSRNOG00000005330
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.