Anti CREB3L3 pAb (ATL-HPA056228 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA056228-25
  • Immunohistochemistry analysis in human duodenum and pancreas tissues using Anti-CREB3L3 antibody. Corresponding CREB3L3 RNA-seq data are presented for the same tissues.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG<br/>Lane 4: Human plasma<br/>Lane 5: Human Liver tissue<br/>Lane 6: Human Tonsil tissue
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: cAMP responsive element binding protein 3-like 3
Gene Name: CREB3L3
Alternative Gene Name: CREB-H
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035041: 55%, ENSRNOG00000032202: 49%
Entrez Gene ID: 84699
Uniprot ID: Q68CJ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DAVPGSEAPGPRPEADTTREESPGSPGADWGFQDTANLTNSTEELDNATLVLRNATEGLGQVALLDWVAPGPSTGSGRAGLE
Gene Sequence DAVPGSEAPGPRPEADTTREESPGSPGADWGFQDTANLTNSTEELDNATLVLRNATEGLGQVALLDWVAPGPSTGSGRAGLE
Gene ID - Mouse ENSMUSG00000035041
Gene ID - Rat ENSRNOG00000032202
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti CREB3L3 pAb (ATL-HPA056228 w/enhanced validation)
Datasheet Anti CREB3L3 pAb (ATL-HPA056228 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CREB3L3 pAb (ATL-HPA056228 w/enhanced validation)