Protein Description: carboxypeptidase Z
Gene Name: CPZ
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036596: 95%, ENSRNOG00000008947: 97%
Entrez Gene ID: 8532
Uniprot ID: Q66K79
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CPZ
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036596: 95%, ENSRNOG00000008947: 97%
Entrez Gene ID: 8532
Uniprot ID: Q66K79
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SYPFDFSKHPQEEKMFSPTPDEKMFKLLSRAYADVHPMMMDRSENRCGGNFLKRGSIINGADWYSFTGGMSDFNY |
| Documents & Links for Anti CPZ pAb (ATL-HPA078608) | |
| Datasheet | Anti CPZ pAb (ATL-HPA078608) Datasheet (External Link) |
| Vendor Page | Anti CPZ pAb (ATL-HPA078608) at Atlas |
| Documents & Links for Anti CPZ pAb (ATL-HPA078608) | |
| Datasheet | Anti CPZ pAb (ATL-HPA078608) Datasheet (External Link) |
| Vendor Page | Anti CPZ pAb (ATL-HPA078608) |