Anti CPSF4 pAb (ATL-HPA049094)

Atlas Antibodies

SKU: ATL-HPA049094-25

• 

Protein Description: cleavage and polyadenylation specific factor 4, 30kDa
Gene Name: CPSF4
Alternative Gene Name: CPSF30, NAR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029625: 100%, ENSRNOG00000000985: 100%
Entrez Gene ID: 10898
Uniprot ID: O95639
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MQEIIASVDHIKFDLEIAVEQQLGAQPLPFPGMDKSGAAVCEFFLKAACGKGGMCPFRHISGEKT
• Gene Sequence: MQEIIASVDHIKFDLEIAVEQQLGAQPLPFPGMDKSGAAVCEFFLKAACGKGGMCPFRHISGEKT
• Gene ID - Mouse: ENSMUSG00000029625
• Gene ID - Rat: ENSRNOG00000000985
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.