Anti CPNE1 pAb (ATL-HPA047259 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA047259-100
  • Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoplasm & nuclear membrane.
  • Western blot analysis in human cell lines Caco-2 and U2OS using Anti-CPNE1 antibody. Corresponding CPNE1 RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: copine I
Gene Name: CPNE1
Alternative Gene Name: CPN1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074643: 87%, ENSRNOG00000046990: 85%
Entrez Gene ID: 8904
Uniprot ID: Q99829
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KNNLNPTWKRFSVPVQHFCGGNPSTPIQVQCSDYDSDGS
Gene Sequence KNNLNPTWKRFSVPVQHFCGGNPSTPIQVQCSDYDSDGS
Gene ID - Mouse ENSMUSG00000074643
Gene ID - Rat ENSRNOG00000046990
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CPNE1 pAb (ATL-HPA047259 w/enhanced validation)
Datasheet Anti CPNE1 pAb (ATL-HPA047259 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CPNE1 pAb (ATL-HPA047259 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CPNE1 pAb (ATL-HPA047259 w/enhanced validation)
Datasheet Anti CPNE1 pAb (ATL-HPA047259 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CPNE1 pAb (ATL-HPA047259 w/enhanced validation)