Anti CPB1 pAb (ATL-HPA046340 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA046340-25
  • Immunohistochemistry analysis in human pancreas and skeletal muscle tissues using Anti-CPB1 antibody. Corresponding CPB1 RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: carboxypeptidase B1 (tissue)
Gene Name: CPB1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000011463: 62%, ENSRNOG00000030904: 59%
Entrez Gene ID: 1360
Uniprot ID: P15086
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HGGEHFEGEKVFRVNVEDENHINIIRELASTTQIDFWKPDSVTQIKPHSTVDFRVKAEDTVTVENVLK
Gene Sequence HGGEHFEGEKVFRVNVEDENHINIIRELASTTQIDFWKPDSVTQIKPHSTVDFRVKAEDTVTVENVLK
Gene ID - Mouse ENSMUSG00000011463
Gene ID - Rat ENSRNOG00000030904
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CPB1 pAb (ATL-HPA046340 w/enhanced validation)
Datasheet Anti CPB1 pAb (ATL-HPA046340 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CPB1 pAb (ATL-HPA046340 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CPB1 pAb (ATL-HPA046340 w/enhanced validation)
Datasheet Anti CPB1 pAb (ATL-HPA046340 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CPB1 pAb (ATL-HPA046340 w/enhanced validation)